Description

  • Product name

    Recombinant Human FGF9/GAF protein (Fc Chimera)
    See all FGF9/GAF proteins and peptides
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTD LDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVG LVSIRGVDSGLYLGMNEKGE LYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPR EGTRTKRHQK FTHFLPRPVDPDKVPELYKDILSQS
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      4 to 208
    • Additional sequence information

      Mature form with Fc fragment of human IgG1 at the N-terminus

Specifications

Our Abpromise guarantee covers the use of ab179967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as FGF9.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µL sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • FGF 9
    • FGF-9
    • FGF9
    • FGF9_HUMAN
    • Fibroblast growth factor 9
    • GAF
    • GAF (Glia-activafibroblast growth factor 9 (glia-activating factor)
    • Glia Activating Factor
    • Glia-activating factor
    • HBFG 9
    • HBFG9
    • HBGF-9
    • Heparin-binding growth factor 9
    • MGC119914
    • MGC119915
    • SYNS3
    see all
  • Function

    May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
  • Tissue specificity

    Glial cells.
  • Involvement in disease

    Defects in FGF9 are the cause of multiple synostoses syndrome type 3 (SYNS3) [MIM:612961]. Multiple synostoses syndrome is an autosomal dominant condition characterized by progressive joint fusions of the fingers, wrists, ankles and cervical spine, characteristic facies and progressive conductive deafness.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Post-translational
    modifications

    Three molecular species were found (30 kDa, 29 kDa and 25 kDa), cleaved at Leu-4, Val-13 and Ser-34 respectively. The smaller ones might be products of proteolytic digestion. Furthermore, there may be a functional signal sequence in the 30 kDa species which is uncleavable in the secretion step.
    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The purity of ab179967 was determined by DTT-reduced (lane 1) and non-reduced (lane 2) SDS-PAGE and staining overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 55 kDa and non-reduced protein migrates as 110 kDa.

References

ab179967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up