Recombinant human FGFBP1 protein (Active) (ab238346)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
Description
-
Product name
Recombinant human FGFBP1 protein (Active)
See all FGFBP1 proteins and peptides -
Biological activity
Determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors. The expected ED50 for this effect is 1.5-3.0 μg/ml.
-
Purity
> 95 % SDS-PAGE.
Greater than 95% by HPLC analyses. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MKKKVKNGLHSKVVSEQKDTLGNTQIKQKSRPGNKGKFVTKDQANCRWAA TEQEEGISLKVECTQLDHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRS QKDICRYSKTAVKTRVCRKDFPESSLKLVSSTLFGNTKPRKEKTEMSPRE HIKGKETTPSSLAVTQTMATKAPECVEDPDMANQRKTALEFCGETWSSLC TFFLSIVQDTSC -
Predicted molecular weight
24 kDa -
Amino acids
24 to 234 -
Additional sequence information
Mature full-length chain lacking the signal peptide.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab238346 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.29% Sodium citrate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in water to 0.1 - 1.0 mg/ml.
General Info
-
Alternative names
- 17 kDa HBGF-binding protein
- 17 kDa heparin binding growth factor binding protein
- 17 kDa heparin-binding growth factor-binding protein
see all -
Function
Acts as a carrier protein that release fibroblast-binding factors (FGFs) from the extracellular matrix (EM) storage and thus enhance the mitogenic activity of FGFs. Enhances FGF2 signaling during tissue repair, angiogenesis and in tumor growth. -
Tissue specificity
Expressed in the suprabasal region of the epidermis, in hair follicles, the basement membrane at the dermo-epidermal junction (occasionally extending into the basement membrane of dermal blood vessels), wounded skin and several invasive squamous cell carcinomas (at protein level). Expressed in normal and wounded skin and various squamous cell carcinomas. -
Sequence similarities
Belongs to the fibroblast growth factor-binding protein family. -
Cellular localization
Secreted, extracellular space. Cell membrane. Extracellular and plasma membrane-associated. Colocalizes with HSPG2 in the pericellular environment of squamous cell carcinomas. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab238346 has not yet been referenced specifically in any publications.