Description

  • Product name

    Recombinant human FGFBP1 protein (Active)
    See all FGFBP1 proteins and peptides
  • Biological activity

    Determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors. The expected ED50 for this effect is 1.5-3.0 μg/ml.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKKKVKNGLHSKVVSEQKDTLGNTQIKQKSRPGNKGKFVTKDQANCRWAA TEQEEGISLKVECTQLDHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRS QKDICRYSKTAVKTRVCRKDFPESSLKLVSSTLFGNTKPRKEKTEMSPRE HIKGKETTPSSLAVTQTMATKAPECVEDPDMANQRKTALEFCGETWSSLC TFFLSIVQDTSC
    • Predicted molecular weight

      24 kDa
    • Amino acids

      24 to 234
    • Additional sequence information

      Mature full-length chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab238346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to 0.1 - 1.0 mg/ml.

General Info

  • Alternative names

    • 17 kDa HBGF-binding protein
    • 17 kDa heparin binding growth factor binding protein
    • 17 kDa heparin-binding growth factor-binding protein
    • FGF binding protein 1
    • FGF BP
    • FGF BP1
    • FGF-binding protein 1
    • FGF-BP
    • FGF-BP1
    • FGFBP
    • FGFBP-1
    • Fgfbp1
    • FGFP1_HUMAN
    • Fibroblast growth factor binding protein 1 precursor
    • Fibroblast growth factor-binding protein 1
    • HBp17
    see all
  • Function

    Acts as a carrier protein that release fibroblast-binding factors (FGFs) from the extracellular matrix (EM) storage and thus enhance the mitogenic activity of FGFs. Enhances FGF2 signaling during tissue repair, angiogenesis and in tumor growth.
  • Tissue specificity

    Expressed in the suprabasal region of the epidermis, in hair follicles, the basement membrane at the dermo-epidermal junction (occasionally extending into the basement membrane of dermal blood vessels), wounded skin and several invasive squamous cell carcinomas (at protein level). Expressed in normal and wounded skin and various squamous cell carcinomas.
  • Sequence similarities

    Belongs to the fibroblast growth factor-binding protein family.
  • Cellular localization

    Secreted, extracellular space. Cell membrane. Extracellular and plasma membrane-associated. Colocalizes with HSPG2 in the pericellular environment of squamous cell carcinomas.
  • Information by UniProt

References

ab238346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up