Description

  • Product name

    Recombinant human FGFR1 alpha protein (Fc Chimera)
    See all FGFR1 alpha proteins and peptides
  • Biological activity

    Determined by its ability to inhibit human FGF acidic dependent proliferation on R1 cells. The ED50 for this effect is typically at 15.0-30.0 ng/ml.

  • Purity

    > 90 % SDS-PAGE.
    Purity: > 90%, by SDS-PAGE and visualised by silver stain.
  • Expression system

    Baculovirus
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGV QLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDA LPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAA KTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVV PSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGS NVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDK EMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTS PLYLEDPRRASIEGRGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K
    • Amino acids

      22 to 376
    • Additional sequence information

      Fused with the Fc region of Human IgG1 at the C-terminus via a Xa cleavage site.

Specifications

Our Abpromise guarantee covers the use of ab55758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in PBS or medium to a concentration not lower than 50µg/ml. Soluble in water and most aqueous buffers.

General Info

  • Alternative names

    • BFGFR
    • CD331
    • CEK
    • FGFBR
    • FGFR1
    • FLG
    • FLT2
    • FMS like tyrosine kinase 2
    • HBGFR
    • KAL2
    • N SAM
    • OGD
    see all
  • Relevance

    FGFR1 (fibroblast growth factor receptor 1) is a member of the fibroblast growth factor receptor family and contains an Ig-like domain and a tyrosine kinase domain. This receptor has multiple isoforms and is a Type I membrane protein. FGFR1 is widely expressed, with distinct isoforms expressed in specific tissues. FGFR1 binds fibroblast growth factor and induces mitogenesis and cellular differentiation. Defects in FGFR1 result in Pfeiffer syndrome associated with craniosynostosis. FGFR1 can be modified by phosphorylation and can bind basic/acidic fibroblast factor depending on the receptor isoform. FGFR1 has been shown to interact with N-cadherin and NCAM.
  • Cellular localization

    Cell Membrane

Images

  • Inhibition of the basic FGF-induced proliferation of HUVE cells by recombinant human sFGFR-1-Fc. HUVECs were stimulated with 10 ng/ml bFGF, the soluble receptor was added with a 50 - 200X excess.
  • Inhibition of the basic FGF-induced proliferation of NHDF cells by recombinant human sFGFR-1-Fc. NHDF cells were stimulated with 10 ng/ml bFGF, the soluble receptor was added with a 50 - 200X excess.
  • SDS-PAGE analysis of recombinant human soluble FGFR-1/Fc produced in insect cells. Sample was loaded in 10% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.

References

ab55758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us.

The protein is a dimer and has a MW of approximately 170 kD.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up