Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRL LMASKKDDPGIIMKLKEQHSKIDMVHRNKSEGFFLDASRHILEAPQHGLE RRHLEANQ
    • Amino acids
      62 to 169
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp564O1863
    • FGFR1 oncogene partner 2
    • FGFR1OP2
    • FGOP2_HUMAN
    • Fibroblast growth factor receptor 1 oncogene partner 2
    • HSPC123
    • HSPC123 like
    • WIT3.0
    • Wound inducible transcript 3.0
    see all
  • Function
    May be involved in wound healing pathway.
  • Tissue specificity
    Expressed in bone marrow, spleen and thymus.
  • Involvement in disease
    Note=A chromosomal aberration involving FGFR1OP2 may be a cause of stem cell myeloproliferative disorder (MPD). Insertion ins(12;8)(p11;p11p22) with FGFR1. MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma. In general it progresses to acute myeloid leukemia. The fusion protein FGFR1OP2-FGFR1 may exhibit constitutive kinase activity and be responsible for the transforming activity.
  • Sequence similarities
    Belongs to the SIKE family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161902 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up