Bioactive grade

Recombinant human FGFRL1 protein (Fc Chimera) (ab191982)

Description

  • Product name

    Recombinant human FGFRL1 protein (Fc Chimera)
    See all FGFRL1 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human aFGF at 10 μg/ml ( 100 μl/well ) can bind ab191982 with a linear range of 0.16 - 2 μg/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPLTMWTKDGRTIHSGW SRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGK ESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVA SGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVS NRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDV KPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL ITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATS LPWP
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      25 to 378
    • Additional sequence information

      Topological domain of FGFRL1 fused with Fc fragment of Human IgG1 at the C-terminus. (Accession # AAH36769)

Specifications

Our Abpromise guarantee covers the use of ab191982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Please see notes section.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a stock solution of 200ug/ml. After reconstitution store under sterile conditions at -70 degrees.

General Info

  • Alternative names

    • FGF homologous factor receptor
    • FGF receptor like protein 1
    • FGF receptor-like protein 1
    • FGFR 5
    • FGFR like protein
    • FGFR-5
    • FGFR-like protein
    • FGFR5
    • Fgfrl1
    • FGRL1_HUMAN
    • FHFR
    • Fibroblast growth factor receptor 5
    • Fibroblast growth factor receptor like 1
    • Fibroblast growth factor receptor-like 1
    see all
  • Function

    Has a negative effect on cell proliferation.
  • Tissue specificity

    Expressed preferentially in cartilaginous tissues and pancreas. Highly expressed in the liver, kidney, heart, brain and skeletal muscle. Weakly expressed in the lung, small intestine and spleen.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane. Predominantly localized in the plasma membrane but also detected in the Golgi and in secretory vesicles.
  • Information by UniProt

Images

  • The purity of ab191982 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 85-95 kDa due to glycosylation.

References

ab191982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up