Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFS RIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
    • Amino acids
      24 to 123
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FGL2
    • FGL2_HUMAN
    • fibrinogen like 2
    • Fibrinogen like protein 2
    • Fibrinogen-like protein 2
    • Fibroleukin
    • pT49
    • T49
    see all
  • Function
    May play a role in physiologic lymphocyte functions at mucosal sites.
  • Tissue specificity
    Constitutively expressed in cytotoxic T-cells.
  • Sequence similarities
    Contains 1 fibrinogen C-terminal domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab161183 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up