Description

  • Product name

    Recombinant Human FHL2 protein
    See all FHL2 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCD CKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSK CQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFC VPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRF TARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFN CKKCSLSLVGRGFLTERDDILCPDCGKDI
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      1 to 279

Specifications

Our Abpromise guarantee covers the use of ab132098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AAG 11
    • AAG11
    • Aging associated gene 11
    • Down regulated in rhabdomyosarcoma LIM protein
    • Downregulated in rhabdomyosarcoma LIM protein
    • DRAL
    • FHL 2
    • FHL-2
    • Fhl2
    • FHL2 protein
    • FHL2_HUMAN
    • Four and a half LIM domain protein 2
    • Four and a half LIM domains 2
    • Four and a half LIM domains protein 2
    • KIAA0990
    • LIM domain protein DRAL
    • Skeletal muscle LIM protein 3
    • Skeletal muscle LIM-protein 3
    • SLIM 3
    • SLIM-3
    • SLIM3
    see all
  • Function

    May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth.
  • Tissue specificity

    Expressed in skeletal muscle and heart.
  • Sequence similarities

    Contains 4 LIM zinc-binding domains.
  • Domain

    The third LIM zinc-binding mediates interaction with E4F1.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132098 stained with Coomassie Blue.

References

ab132098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up