Overview

  • Product name
    Recombinant Human FHOD1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPL GAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFY
    • Amino acids
      2 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FH1/FH2 domain containing protein
    • FH1/FH2 domain containing protein 1
    • FH1/FH2 domain-containing protein 1
    • Fhod1
    • FHOD1_HUMAN
    • FHOS
    • FHOS1
    • Formin homolog overexpressed in spleen 1
    • Formin homology 2 domain containing 1
    • Formin homology 2 domain containing protein 1
    • Formin homology 2 domain-containing protein 1
    see all
  • Function
    Required for the assembly of F-actin structures, such as stress fibers. Depends on the Rho-ROCK cascade for its activity. Contributes to the coordination of microtubules with actin fibers and plays a role in cell elongation.
  • Tissue specificity
    Ubiquitous. Highly expressed in spleen.
  • Sequence similarities
    Belongs to the formin homology family.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Domain
    Regulated by intramolecular binding to a C-terminal auto-inhibitory domain. Effector binding abolishes this interaction and activates the protein.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Predominantly cytoplasmic.
  • Information by UniProt

Images

  • ab162223 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up