Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMTSELDIFVGNTTLIDEDVYRLWLDGY SVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLL HQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKT GITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIV FFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDPDSQMD DMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEA NFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFF LNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
    • Molecular weight

      44 kDa including tags
    • Amino acids

      1 to 364
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab156710 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Acidic fibroblast growth factor intracellular-binding protein
    • aFGF intracellular-binding protein
    • FGF-1 intracellular-binding protein
    • FGFIBP
    • FIBP
    • FIBP-1
    • FIBP_HUMAN
    • FIBP1
    • fibroblast growth factor (acidic) intracellular binding protein
    • OTTHUMP00000234231
    • OTTHUMP00000234232
    • OTTHUMP00000234233
    see all
  • Function

    May be involved in mitogenic function of FGF1.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.
  • Cellular localization

    Nucleus. Endomembrane system. Also associated with cytoplasmic membranes, particularly of mitochondria.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156710 (3µg).

References

ab156710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up