Description

  • Product name

    Recombinant Human Fibrillarin protein
  • Purity

    >= 85 % SDS-PAGE.
    ab99443 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHRSMGKNVMVEPHRHEGVFICRGKEDALVTK NLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKP GAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTN IIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGH FVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVV VGVYRPPPKVKN
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      83 to 321
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.0292% EDTA, 20% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • 34 kD nucleolar scleroderma antigen
    • 34 kDa nucleolar scleroderma antigen
    • Fbl
    • FBRL_HUMAN
    • FIB
    • FIB1
    • FLRN
    • Histone-glutamine methyltransferase
    • Nop1p
    • RNA U3 small nucleolar interacting protein 1
    • RNU3IP1
    • rRNA 2' O methyltransferase fibrillarin
    • rRNA 2'-O-methyltransferase fibrillarin
    see all
  • Function

    S-adenosyl-L-methionine-dependent methyltransferase that has the ability to methylate both RNAs and proteins. Involved in pre-rRNA processing by catalyzing the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA. Also acts as a protein methyltransferase by mediating methylation of 'Gln-105' of histone H2A (H2AQ104me), a modification that impairs binding of the FACT complex and is specifically present at 35S ribosomal DNA locus (PubMed:24352239).
  • Sequence similarities

    Belongs to the methyltransferase superfamily. Fibrillarin family.
  • Post-translational
    modifications

    By homology to other fibrillarins, some or all of the N-terminal domain arginines are modified to asymmetric dimethylarginine (DMA).
  • Cellular localization

    Nucleus, nucleolus. Fibrillar region of the nucleolus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99443 at approximately 28.9kDa (3µg).

References

ab99443 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up