Description

  • Product name

    Recombinant Human Fibrinogen gamma chain protein
  • Purity

    > 90 % SDS-PAGE.
    ab202200 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSYVATRDNCCILDERFGSYCPTTCGIAD FLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPN MIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEK VAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQ FLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFW LGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLT YAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCA EQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWY SMKKTTMKIIPFNRLTIGEGQQHHLGGAKQAGDV
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      27 to 437
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 27 to 437 of Human Fibrinogen gamma chain Isoform Gamma A (NP_000500). The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab202200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • FGG
    • FIBG_HUMAN
    • Fibrinogen gamma chain
    • Fibrinogen gamma polypeptide
    • fibrinogen gamma-b chain
    see all
  • Function

    Fibrinogen has a double function: yielding monomers that polymerize into fibrin and acting as a cofactor in platelet aggregation.
  • Involvement in disease

    Defects in FGG are a cause of thrombophilia.
    Defects in FGG are a cause of congenital afibrinogenemia (CAFBN) [MIM:202400]. It is a rare autosomal recessive disorder characterized by complete absence of detectable fibrinogen.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Domain

    A long coiled coil structure formed by 3 polypeptide chains connects the central nodule to the C-terminal domains (distal nodules). The long C-terminal ends of the alpha chains fold back, contributing a fourth strand to the coiled coil structure.
  • Post-translational
    modifications

    Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot. The soft clot is converted into the hard clot by factor XIIIA which catalyzes the epsilon-(gamma-glutamyl)lysine cross-linking between gamma chains (stronger) and between alpha chains (weaker) of different monomers.
    Sulfation of C-terminal tyrosines increases affinity for thrombin.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202200 (3 µg).

References

ab202200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up