Description

  • Product name

    Recombinant Human Fibronectin type III EDB protein
    See all Fibronectin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab209886 was sterile-filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFNVSVYTVKDDKESVPISDTII PEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFED FVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDL RFTNIGPDTMRVT
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      1244 to 1377
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      FN-III EDB domain constructed by fully synthetic gene synthesis with codon optimization and expressed with an N-terminal 29aa T7-His-TEV cleavage site.
  • Description

    Recombinant Human Fibronectin protein

Specifications

Our Abpromise guarantee covers the use of ab209886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab209886 was expressed in E.coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.

    Extracellular matrix protein fibronectin (FN) plays an important role in cell adhesion. FN contains FN type I, II and III domains. The FN III repeat is generally about 90 amino acid long and to be composed of seven b-strands, forming two antiparallel b-sheets. In the C-terminal of human fibronectin region, there are 16 FN-III repeat domains. FN III domain derived proteins have been demonstrated to bind various proteins with high affinity. The alternatively-spliced extra-domain B (EDB) of fibronectin represents one of the best characterized markers of angiogenesis. This domain of 91-aminoacids is completely identical between mouse and man, is virtually absent in normal adult tissues (exception made for the endometrium in the proliferative phase and some vessels of the ovaries), but is strongly expressed in most aggressive solid cancer types, with a prominent vascular and/or stromal pattern of expression.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • CIG
    • Cold insoluble globulin
    • Cold-insoluble globulin
    • DKFZp686F10164
    • DKFZp686H0342
    • DKFZp686I1370
    • DKFZp686O13149
    • ED B
    • Fibronectin 1
    • FINC
    • FINC_HUMAN
    • FN
    • FN1
    • FNZ
    • GFND
    • GFND2
    • LETS
    • Migration stimulating factor
    • MSF
    • Ugl-Y3
    see all
  • Function

    Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.
    Anastellin binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling.
  • Tissue specificity

    Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl-Y2 and Ugl-Y3 are found in urine.
  • Involvement in disease

    Glomerulopathy with fibronectin deposits 2
  • Sequence similarities

    Contains 12 fibronectin type-I domains.
    Contains 2 fibronectin type-II domains.
    Contains 16 fibronectin type-III domains.
  • Developmental stage

    Ugl-Y1, Ugl-Y2 and Ugl-Y3 are present in the urine from 0 to 17 years of age.
  • Post-translational
    modifications

    Sulfated.
    It is not known whether both or only one of Thr-2064 and Thr-2065 are/is glycosylated.
    Forms covalent cross-links mediated by a transglutaminase, such as F13A or TGM2, between a glutamine and the epsilon-amino group of a lysine residue, forming homopolymers and heteropolymers (e.g. fibrinogen-fibronectin, collagen-fibronectin heteropolymers).
    Phosphorylated by FAM20C in the extracellular medium.
    Proteolytic processing produces the C-terminal NC1 peptide, anastellin.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt

References

ab209886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up