Overview

  • Product name

    Recombinant Human Fibulin-4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFELSPQDSEEPDSYTECTDGYE WDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGE GPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLP GSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQL GPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDI DECSYSSYLCQYRCINEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQC SEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIV HRYMTITSERSVPADVFQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINN VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF
    • Molecular weight

      50 kDa including tags
    • Amino acids

      26 to 443
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Mature form. T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab182808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as EFEMP2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • EFEMP 2
    • EFEMP2
    • EGF containing fibulin like extracellular matrix protein 2
    • EGF-containing fibulin-like extracellular matrix protein 2
    • FBLN 4
    • FBLN4
    • FBLN4_HUMAN
    • FIBL 4
    • FIBL-4
    • FIBL4
    • Fibulin 4
    • Fibulin-4
    • MBP 1
    • MBP1
    • Mutant p53 binding protein 1
    • Protein UPH1
    • UPH 1
    • UPH1
    • UPH1 protein
    see all
  • Involvement in disease

    Defects in EFEMP2 are a cause of cutis laxa autosomal recessive type 1 (ARCL1) [MIM:219100]. Hereditary cutis laxa refers to a heterogeneous group of connective tissue disorders characterized by cutaneous abnormalities and variable systemic manifestations. The most constant clinical feature is loose skin, sagging over the face and trunk. Hereditary cutis laxa is inherited in both autosomal dominant and autosomal recessive modes. ARCL1 shows the most severe phenotype and has the poorest prognosis. In addition to the skin, internal organs enriched in elastic fibers, such as the lung and arteries, are affected.
  • Sequence similarities

    Belongs to the fibulin family.
    Contains 6 EGF-like domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab182808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up