Overview

  • Product name

    Recombinant Human Ficolin 2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILR GCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLT GPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVD GSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFED NYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDN DLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYN YSYKVSEMKVRPA
    • Amino acids

      1 to 313
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 37 kDa elastin-binding protein
    • Collagen/fibrinogen domain containing protein 2
    • Collagen/fibrinogen domain-containing protein 2
    • EBP 37
    • EBP-37
    • EBP37
    • FCN 2
    • Fcn2
    • FCN2_HUMAN
    • FCNL
    • Ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
    • Ficolin B
    • Ficolin beta
    • Ficolin-2
    • Ficolin-B
    • Ficolin-beta
    • Ficolin2
    • Hucolin
    • L ficolin
    • L-ficolin
    • OTTHUMP00000022518
    • P35
    • RP11 263F14.2
    • Serum lectin p35
    see all
  • Function

    May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Belongs to the ficolin lectin family.
    Contains 1 collagen-like domain.
    Contains 1 fibrinogen C-terminal domain.
  • Domain

    The fibrinogen-like domain (FBG) contains potential calcium-binding sites that may be involved in carbohydrate binding.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab158426 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up