Overview

  • Product name

    Recombinant Human FIF protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKV EIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYER SLQGK
    • Amino acids

      400 to 504
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Apoptosis inhibitor 5. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AAC 11
    • AAC-11
    • AAC11
    • Antiapoptosis clone 11 protein
    • API 5
    • API-5
    • api5
    • API5 like 1
    • API5_HUMAN
    • API5L1
    • Apoptosis inhibitor 5
    • Cell migration inducing gene 8 protein
    • Cell migration-inducing gene 8 protein
    • Fibroblast growth factor 2 interacting factor 2
    • Fibroblast growth factor 2-interacting factor
    • FIF
    • MIG 8
    • MIG8
    • Migration inducing protein MIG8
    • Protein XAGL
    see all
  • Function

    Antiapoptotic factor that may have a role in protein assembly. Negatively regulates ACIN1. By binding to ACIN1, it suppresses ACIN1 cleavage from CASP3 and ACIN1-mediated DNA fragmentation. Also known to efficiently suppress E2F1-induced apoptosis. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs.
  • Tissue specificity

    Expressed in all tissues tested, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highest levels in heart, pancreas and placenta. Highly expressed in several cancers. Preferentially expressed in squamous cell carcinoma versus adenocarcinoma in non-small cell lung cancer.
  • Sequence similarities

    Belongs to the API5 family.
  • Domain

    Two regions, an N-terminal (aa 96-107) and a C-terminal (aa 274-311) are required for binding FGF2.
  • Cellular localization

    Cytoplasm and Nucleus. Cytoplasm. Mainly nuclear. Can also be cytoplasmic.
  • Information by UniProt

Images

  • ab160084 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up