Recombinant Human FIGLA protein (ab166309)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human FIGLA protein
See all FIGLA proteins and peptides -
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceMDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLP SGGYSSTENLQLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRK PSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNNSSESHTSSAR QLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPT RSLDRFPEVELLSHRLPQV
-
Amino acids1 to 219
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab166309 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- bHLHc8
- Class C basic helix-loop-helix protein 8
- Factor in the germline alpha
see all -
FunctionGermline specific transcription factor implicated in postnatal oocyte-specific gene expression. Plays a key regulatory role in the expression of multiple oocyte-specific genes, including those that initiate folliculogenesis and those that encode the zona pellucida (ZP1, ZP2 and ZP3) required for fertilization and early embryonic survival. Essential for oocytes to survive and form primordial follicles. The persistence of FIGLA in adult females suggests that it may regulate additional pathways that are essential for normal ovarian development. Binds to the E-box (5'-CANNTG-3') of the ZPs (ZP1, ZP2, ZP3) promoters.
-
Tissue specificityGerm cells. Expressed in the fetal ovary, but not by a range of other tissues. Expression increases across mid-gestation, rising some 40-fold by the time of primordial follicle formation.
-
Involvement in diseaseDefects in FIGLA are the cause of premature ovarian failure type 6 (POF6) [MIM:612310]. An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
-
Sequence similaritiesContains 1 bHLH (basic helix-loop-helix) domain.
-
Developmental stageExpressed in ovarian follicles (from the primordial through to the secondary stage), in mature oocytes, and less frequently in preimplantation embryos.
-
Cellular localizationNucleus.
- Information by UniProt
Images
Datasheets and documents
References
ab166309 has not yet been referenced specifically in any publications.