Description

  • Product name

    Recombinant Human FIGLA protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLP SGGYSSTENLQLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRK PSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNNSSESHTSSAR QLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPT RSLDRFPEVELLSHRLPQV
    • Amino acids

      1 to 219
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bHLHc8
    • Class C basic helix-loop-helix protein 8
    • Factor in the germline alpha
    • FIGalpha
    • FIGLA
    • FIGLA_HUMAN
    • Folliculogenesis specific basic helix loop helix
    • Folliculogenesis-specific basic helix-loop-helix protein
    • POF6
    • Transcription factor FIGa
    see all
  • Function

    Germline specific transcription factor implicated in postnatal oocyte-specific gene expression. Plays a key regulatory role in the expression of multiple oocyte-specific genes, including those that initiate folliculogenesis and those that encode the zona pellucida (ZP1, ZP2 and ZP3) required for fertilization and early embryonic survival. Essential for oocytes to survive and form primordial follicles. The persistence of FIGLA in adult females suggests that it may regulate additional pathways that are essential for normal ovarian development. Binds to the E-box (5'-CANNTG-3') of the ZPs (ZP1, ZP2, ZP3) promoters.
  • Tissue specificity

    Germ cells. Expressed in the fetal ovary, but not by a range of other tissues. Expression increases across mid-gestation, rising some 40-fold by the time of primordial follicle formation.
  • Involvement in disease

    Defects in FIGLA are the cause of premature ovarian failure type 6 (POF6) [MIM:612310]. An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
  • Sequence similarities

    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Developmental stage

    Expressed in ovarian follicles (from the primordial through to the secondary stage), in mature oocytes, and less frequently in preimplantation embryos.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab166309 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up