Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASQVLVYPPYVYQTQSSAFCSVKKLKVEPSSCVFQERNYPRTYVNGRNF GNSHPPTKGSAFQTKIPFNRPRGHNFSLQTSAVVLKNTAGATKVI
    • Amino acids
      1 to 95
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as HIPK3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Androgen receptor interacting nuclear protein kinase
    • Androgen receptor-interacting nuclear protein kinase
    • ANPK
    • DYRK6
    • Fas interacting serine/threonine protein kinase
    • Fas-interacting serine/threonine-protein kinase
    • FIST
    • FIST3
    • Hipk3
    • HIPK3_HUMAN
    • homeodomain interacting protein kinase 3
    • Homeodomain-interacting protein kinase 3
    • Homolog of protein kinase YAK1
    • PKY
    • RP24 297H17.5
    • YAK1
    see all
  • Function
    Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors.
  • Tissue specificity
    Overexpressed in multidrug resistant cells. Highly expressed in heart and skeletal muscle, and at lower levels in placenta, pancreas, brain, spleen, prostate, thymus, testis, small intestine, colon and leukocytes. Not found in liver and lung.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated, but autophosphorylation is not required for catalytic activity.
    May be sumoylated.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab160827 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up