Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      CQPLIKGRSAPGRLNQPSAVGTRQQKLTSAFQQQHLNFSQVQHFGSGHQE WNGNFGHRRQQAYIPTSVTSNPFTLSHGSPNHTAVHAHLAGNTHLGGQPT
    • Amino acids

      1018 to 1117
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as HIPK3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Androgen receptor interacting nuclear protein kinase
    • Androgen receptor-interacting nuclear protein kinase
    • ANPK
    • DYRK6
    • Fas interacting serine/threonine protein kinase
    • Fas-interacting serine/threonine-protein kinase
    • FIST
    • FIST3
    • Hipk3
    • HIPK3_HUMAN
    • homeodomain interacting protein kinase 3
    • Homeodomain-interacting protein kinase 3
    • Homolog of protein kinase YAK1
    • PKY
    • RP24 297H17.5
    • YAK1
    see all
  • Function

    Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors.
  • Tissue specificity

    Overexpressed in multidrug resistant cells. Highly expressed in heart and skeletal muscle, and at lower levels in placenta, pancreas, brain, spleen, prostate, thymus, testis, small intestine, colon and leukocytes. Not found in liver and lung.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated, but autophosphorylation is not required for catalytic activity.
    May be sumoylated.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab160828 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up