Recombinant Human FKBP11 protein (ab162501)

Description

  • Product name

    Recombinant Human FKBP11 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPC AEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSL LDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWL KLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKK K
    • Amino acids

      1 to 201
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 19 kDa FK506 binding protein
    • 19 kDa FK506-binding protein
    • 19 kDa FKBP
    • FK506 binding protein 11
    • FK506 binding protein 11 (19 kDa)
    • FK506-binding protein 11
    • FKB11_HUMAN
    • FKBP 19
    • FKBP-11
    • FKBP-19
    • Fkbp11
    • FKBP19
    • MGC54182
    • Peptidyl prolyl cis trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP11
    • PPIase
    • PPIase FKBP11
    • Rotamase
    see all
  • Function

    PPIases accelerate the folding of proteins during protein synthesis.
  • Sequence similarities

    Belongs to the FKBP-type PPIase family.
    Contains 1 PPIase FKBP-type domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab162501 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up