Description

  • Product name

    Recombinant Human FKBP2 protein
    See all FKBP2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLP QNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKI PGGATLVFEVELLKIERRTELVDHHHHHH
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      22 to 142
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length mature form, without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab191956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.32% Tris HCl, 0.87% Sodium chloride

General Info

  • Alternative names

    • 13 kDa FK506-binding protein
    • 13 kDa FKBP
    • EC 5.2.1.8
    • FK506 binding protein 2 (13kD)
    • FK506 binding protein 2 13kDa
    • FK506-binding protein 2
    • FK506-binding protein, T-cell, 13-KD
    • FKBP 13
    • FKBP 2
    • FKBP-13
    • FKBP-2
    • FKBP13
    • FKBP2
    • FKBP2_HUMAN
    • Immunophilin FKBP13
    • Peptidyl prolyl cis trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP2
    • PPIase
    • PPIase FKBP2
    • Proline isomerase
    • Rapamycin binding protein
    • Rotamase
    see all
  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity

    T-cells and thymus.
  • Sequence similarities

    Belongs to the FKBP-type PPIase family. FKBP2 subfamily.
    Contains 1 PPIase FKBP-type domain.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

References

ab191956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up