Description

  • Product name

    Recombinant Human FKBP52 protein
    See all FKBP52 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    As determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIG DRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVG EVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGI IRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDL PYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLK SFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDS NNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRI RRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAG SQSQVETEALEHHHHHH
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      1 to 459
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 10% Glycerol

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • 51 kDa FK506-binding protein
    • 52 kDa FK506 binding protein
    • 52 kDa FK506-binding protein
    • 52 kDa FKBP
    • 59 kDa immunophilin
    • FK506 binding protein 4
    • FK506-binding protein 4
    • FKBP 4
    • FKBP 52
    • FKBP 59
    • FKBP-4
    • FKBP-52
    • FKBP4
    • FKBP4_HUMAN
    • FKBP51
    • FKBP52 protein
    • FKBP59
    • HBI
    • Hsp 56
    • HSP binding immunophilin
    • HSP-binding immunophilin
    • Hsp56
    • Immunophilin FKBP52
    • N-terminally processed
    • p52
    • p59
    • p59 protein
    • Peptidyl prolyl cis trans isomerase
    • peptidyl-prolyl cis-trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP4
    • Peptidylprolyl cis trans isomerase
    • PPIase
    • PPIase FKBP4
    • Rotamase
    • T cell FK506 binding protein 59kD
    see all
  • Function

    Immunophilin protein with PPIase and co-chaperone activities (By similarity). Component of unliganded steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments (By similarity). The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening. Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 2 PPIase FKBP-type domains.
    Contains 3 TPR repeats.
  • Domain

    The PPIase activity is mainly due to the fisrt PPIase FKBP-type domain (1-138 AA).
    The C-terminal region (AA 375-458) is required to prevent tubulin polymerization.
    The chaperone activity resides in the C-terminal region, mainly between amino acids 264 and 400.
  • Post-translational
    modifications

    Phosphorylation by CK2 results in loss of HSP90 binding activity (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Cytoplasm > cytoskeleton.
  • Information by UniProt

References

ab185391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up