For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-fkbp52-protein-his-tag-ab219689.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Trafficking Chaperones Heat Shock Proteins
Share by email

Recombinant Human FKBP52 protein (His tag) (ab219689)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human FKBP52 protein (His tag) (ab219689)

    Key features and details

    • Expression system: HEK 293 cells
    • Purity: > 90% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Tags: His tag C-Terminus
    • Suitable for: SDS-PAGE

    Description

    • Product name

      Recombinant Human FKBP52 protein (His tag)
      See all FKBP52 proteins and peptides
    • Purity

      > 90 % SDS-PAGE.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      HEK 293 cells
    • Accession

      Q02790
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIG DRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVG EVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGI IRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDL PYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLK SFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDS NNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRI RRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAG SQSQVETEA
      • Predicted molecular weight

        55 kDa including tags
      • Amino acids

        1 to 459
      • Tags

        His tag C-Terminus
      • Additional sequence information

        This protein carries a polyhistidine tag at the C-terminus, followed by a PA tag (AAH01786).

    Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab219689 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 7.4
      Constituents: 0.61% Tris, 0.75% Glycine

      Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

    • Reconstitution
      Reconstitute with sterile deionized water to a concentration of 100 µg/ml.

    General Info

    • Alternative names

      • 51 kDa FK506-binding protein
      • 52 kDa FK506 binding protein
      • 52 kDa FK506-binding protein
      • 52 kDa FKBP
      • 59 kDa immunophilin
      • FK506 binding protein 4
      • FK506-binding protein 4
      • FKBP 4
      • FKBP 52
      • FKBP 59
      • FKBP-4
      • FKBP-52
      • FKBP4
      • FKBP4_HUMAN
      • FKBP51
      • FKBP52 protein
      • FKBP59
      • HBI
      • Hsp 56
      • HSP binding immunophilin
      • HSP-binding immunophilin
      • Hsp56
      • Immunophilin FKBP52
      • N-terminally processed
      • p52
      • p59
      • p59 protein
      • Peptidyl prolyl cis trans isomerase
      • peptidyl-prolyl cis-trans isomerase
      • Peptidyl-prolyl cis-trans isomerase FKBP4
      • Peptidylprolyl cis trans isomerase
      • PPIase
      • PPIase FKBP4
      • Rotamase
      • T cell FK506 binding protein 59kD
      see all
    • Function

      Immunophilin protein with PPIase and co-chaperone activities (By similarity). Component of unliganded steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments (By similarity). The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening. Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly.
    • Tissue specificity

      Widely expressed.
    • Sequence similarities

      Contains 2 PPIase FKBP-type domains.
      Contains 3 TPR repeats.
    • Domain

      The PPIase activity is mainly due to the fisrt PPIase FKBP-type domain (1-138 AA).
      The C-terminal region (AA 375-458) is required to prevent tubulin polymerization.
      The chaperone activity resides in the C-terminal region, mainly between amino acids 264 and 400.
    • Post-translational
      modifications

      Phosphorylation by CK2 results in loss of HSP90 binding activity (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
    • Cellular localization

      Cytoplasm > cytosol. Nucleus. Cytoplasm > cytoskeleton.
    • Target information above from: UniProt accession Q02790 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human FKBP52 protein (His tag) (ab219689)
      SDS-PAGE - Recombinant Human FKBP52 protein (His tag) (ab219689)

      SDS-PAGE analysis of ab219689 under reducing conditions, stained overnight with Coomassie Blue. The reduced protein migrates at 60 kDa.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab219689? Please let us know so that we can cite the reference in this datasheet.

    ab219689 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab219689.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.