Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTS KKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAM TDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRS IETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKK NDHDGDGFISPKEYNVYQHDEL
    • Amino acids
      1 to 222
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 23 kDa FK506 binding protein
    • 23 kDa FKBP
    • FK506 binding protein 23
    • FK506 binding protein 7
    • FK506-binding protein 7
    • FKBP 23
    • FKBP 7
    • FKBP23
    • Peptidyl prolyl cis trans isomerase FKBP7
    • PPIase
    • PPIase FKBP7
    • Rotamase
    see all
  • Relevance
    FKBP7 belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. PPIases accelerate the folding of proteins during protein synthesis. FKBP7 contains two EF-hand domains and one PPIase FKBP-type domain. There are two named isoforms.
  • Cellular localization
    Endoplasmic reticulum lumen.

Images

  • ab162626 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up