Recombinant Human FKLF / KLF11 protein (ab160043)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKK FVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGS PLVSMPASA
    • Amino acids
      404 to 512
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9830142A17
    • D12Ertd427e
    • FKLF
    • FKLF1
    • Klf11
    • KLF11_HUMAN
    • Krueppel like factor 11
    • Krueppel-like factor 11
    • Krueppel-like transcription factor 1
    • MODY7
    • Tcfcp2l2
    • TGFB Early Growth Response 2
    • TGFB-inducible early growth response protein 2
    • TGFB-inducible early growth response protein 2b
    • TGFB-inducible early growth response protein 3
    • TIEG 2
    • TIEG-2
    • TIEG-3
    • Tieg2b
    • Transforming Growth Factor Beta Inducible Early Growth Response 2
    • Transforming growth factor-beta-inducible early growth response protein 2
    • Transforming growth factor-beta-inducible early growth response protein 3
    see all
  • Function
    Transcription factor. Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling. Induces apoptosis.
  • Tissue specificity
    Ubiquitous. Higher expression in erythroid cells.
  • Involvement in disease
    Defects in KLF11 are the cause of maturity-onset diabetes of the young type 7 (MODY7) [MIM:610508]. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
  • Sequence similarities
    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160043 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160043 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up