Description

  • Product name

    Recombinant Human Flagellin protein (Tagged)
    See all Flagellin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIA NRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATT GTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGAN DNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLT GITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVA NDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGA VSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSG AASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTA VANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSE AQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      2 to 498
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab236196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 41 kDa antigen
    • b1923
    • flaF
    • Flagellar filament 41 kDa core protein
    • Flagellin
    • fliC
    • hag
    • JW1908
    • P41
    see all
  • Relevance

    Flagellin (FliC) is a subunit protein that polymerizes (along with other proteins) to form the filaments of bacterial flagella. Assembly of the bacterial flagellum occurs in a precise, temporal order where the basal component (FlgE, FlgK, and FlgL are assembled inside the bacterial membrane, followed by exportation of the filament cap protein FliD, and secretion of about 20,000 flagellin monomers (FliC) through the channel. FliC monomers are polymerized to form the tail filament. FliC monomers can function as pathogen-associated molecular patterns (PAMPs), and can be detected by host cells through surface-localized toll-like receptor 5 (TLR5) and cytosolic Nod-like receptors (NLRs).
  • Cellular localization

    Secreted. Bacterial flagellum.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel using ab236196.

References

ab236196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up