Overview

  • Product name

    Recombinant Human FLI1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDGTIKEALSVVSDGQSLFDSAYGAAAHLPKADMAASGSPDYGQPHKINP LPPQQEWISQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPM NYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQWLEWAIKEYS LMEIDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLL AYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTI SKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI TWEGTNGEFKMTDPDEVARRWGERISKPNMNYDKLSRALRYYYDKNIMTK VHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNF VPPHPSSMPVTSSSFFGAASQYWTSPTGGIYPNPNVPRHPNTHVPSHLGS YY
    • Molecular weight

      75 kDa including tags
    • Amino acids

      1 to 452

Specifications

Our Abpromise guarantee covers the use of ab132086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ERGB transcription factor
    • Ewing Sarcoma breakpoint region 2
    • EWSR 2
    • EWSR2
    • FLI 1
    • FLI 1 proto oncogene
    • Fli-1 proto-oncogene, ETS transcription factor
    • FLI1
    • FLI1 EWS fusion gene
    • FLI1 proto oncogene
    • FLI1_HUMAN
    • Friend leukemia integration 1 (FLI1) transcription factor
    • Friend leukemia integration 1 transcription factor
    • Friend leukemia virus integration 1
    • Proto-oncogene Fli-1
    • Sarcoma breakpoint region 2 (EWSR2)
    • SIC 1
    • SIC1
    • Transcription factor ERGB
    • Viral integration region FLI1
    • Viral integration region FLI1, mouse, homolog of
    see all
  • Function

    Sequence-specific transcriptional activator. Recognizes the DNA sequence 5'-C[CA]GGAAGT-3'.
  • Involvement in disease

    Defects in FLI1 are a cause of Ewing sarcoma (ES) [MIM:612219]. A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. Note=A chromosomal aberration involving FLI1 is found in patients with Erwing sarcoma. Translocation t(11;22)(q24;q12) with EWSR1.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132086 stained with Coomassie Blue.

References

ab132086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up