Overview

  • Product name

    Recombinant Human FLJ25006 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRS DLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRP IRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVR QCKEEVSIQRQINHPFVHSLGDSWQGKRHL FIMCSYCSTDLYSLWSAV GCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDERGHLKLTDF GLSRHVPQGAQAYTICGTLQYMGERG
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 274
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab203554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 70 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.0038% DTT, 0.00174% PMSF, 25% Glycerol

General Info

  • Alternative names

    • MGC39533
    • SGK494
    • Sugen kinase 494
    • Uncharacterized serine/threonine protein kinase SgK494
  • Relevance

    FLJ25006 likely exerts a protein serine/threonine kinase activity.

Images

  • Analysing the purity of ab203554 by densitometry. 

References

ab203554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up