Description

  • Product name

    Recombinant Human FLJ36353 protein (His tag)
  • Purity

    > 95 % SDS-PAGE.
    SEC-HPLC and reducing SDS-PAGE
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCG VPSPECESFLEHLQR ALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGC EPSCLTYGQTFADGT DLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPR TSILDAAGSGSGSGS GSGPVDHHHHHH*
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      31 to 229
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 31 to 229. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab196051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

    Lyophilized from a 0.2 µm filtered solution

General Info

  • Alternative names

    • FLJ36353
    • Retbindin
    • RTBDN
    • RTBDN_HUMAN
  • Tissue specificity

    Expressed in retina.
  • Sequence similarities

    Belongs to the folate receptor family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab196051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up