Overview

  • Product name

    Recombinant Human FLJ39378 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVA PELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIA QLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQR DEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIE QKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEE SISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYK SEEMEEENRIPQPPPIAHPRTSPQPESGIKRLIFTAIMPMVAAGLIIDDP TLQPVRRLVSLV
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 362

Specifications

Our Abpromise guarantee covers the use of ab132797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GOSPEL
    • MGC105128
    • MGC99793
    • Rab interacting lysosomal protein like 1
    • Rab-interacting lysosomal-like protein 1
    • RILP like protein 1
    • RILP-like protein 1
    • RILPL 1
    • rilpl1
    • RIPL1_HUMAN
    • RLP1
    see all
  • Function

    Neuroprotective protein, which acts by sequestring GAPDH in the cytosol and prevent the apoptotic function of GAPDH in the nucleus. Competes with SIAH1 for binding GAPDH (By similarity). Does not regulate lysosomal morphology and distribution.
  • Tissue specificity

    Widely expressed. Expressed at lower level in liver and kidney.
  • Sequence similarities

    Belongs to the RILPL family.
    Contains 1 RILP-like domain.
  • Post-translational
    modifications

    S-nitrosylation is required for the interaction with GAPDH.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132797 stained with Coomassie Blue.

References

ab132797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up