Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDI KNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEI LSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKK EMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQ QKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQ IAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQ KYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLL AELPASVHALTGVDLSKIPLIKKATGVQV
    • Molecular weight

      67 kDa including tags
    • Amino acids

      50 to 428

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl

    Previously labelled as Flotillin 2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ECS-1
    • ECS1
    • Epidermal surface antigen
    • Epidermal surface antigen 1
    • ESA
    • ESA1
    • Flot2
    • FLOT2_HUMAN
    • Flotillin 2 (epidermal surface antigen 1)
    • Flotillin-2
    • M17S1
    • Membrane component chromosome 17 surface marker 1
    • Membrane component chromosome 17 surface marker 1 homolog
    • Membrane component, chromosome 17, surface marker 1
    • membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal antibody ECS-1)
    • REG-1
    • Reggie-1
    • Reggie-2
    see all
  • Function

    May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. May be involved in epidermal cell adhesion and epidermal structure and function.
  • Tissue specificity

    In skin, expressed in epidermis and epidermal appendages but not in dermis. Expressed in all layers of the epidermis except the basal layer. In hair follicles, expressed in the suprabasal layer but not the basal layer. Also expressed in melanoma and carcinoma cell lines, fibroblasts and foreskin melanocytes.
  • Sequence similarities

    Belongs to the band 7/mec-2 family. Flotillin subfamily.
  • Cellular localization

    Cell membrane. Membrane > caveola. Endosome. Membrane-associated protein of caveolae.
  • Information by UniProt

Images

  • ab131919 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab131919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up