Description

  • Product name

    Recombinant Human Flt3 ligand/Flt3L protein
    See all Flt3 ligand/Flt3L proteins and peptides
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWR LVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQT NISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLE ATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVP SPQDLLLVE
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      26 to 234
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. NP_001450.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab204771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Western blot

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as Flt3 ligand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.31% Glutathione, 99% PBS

General Info

  • Alternative names

    • FL
    • Flt 3 ligand
    • Flt 3L
    • Flt3 L
    • FLT3 LG
    • Flt3 ligand
    • Flt3L
    • FLT3L_HUMAN
    • Flt3lg
    • Fms related tyrosine kinase 3 ligand
    • Fms-related tyrosine kinase 3 ligand
    • SL cytokine
    see all
  • Function

    Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • monoclonal anti GST antibody + Recombinant Human Flt3 ligand/Flt3L protein (ab204771)
  • 10% SDS-PAGE analysis of ab204771 stained with Coomassie Blue.

References

ab204771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up