Bioactive grade

Recombinant human Flt3 ligand/Flt3L protein (ab237554)

Description

  • Product name

    Recombinant human Flt3 ligand/Flt3L protein
    See all Flt3 ligand/Flt3L proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human AML5 cells is less than 1.0 ng/ml, corresponding to a specific activity of >1.0x106 IU/mg.

  • Purity

    > 97 % SDS-PAGE.
    and >97% by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTA
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      27 to 181

Specifications

Our Abpromise guarantee covers the use of ab237554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituent: PBS

    0.2 µm filtered PBS.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FL
    • Flt 3 ligand
    • Flt 3L
    • Flt3 L
    • FLT3 LG
    • Flt3 ligand
    • Flt3L
    • FLT3L_HUMAN
    • Flt3lg
    • Fms related tyrosine kinase 3 ligand
    • Fms-related tyrosine kinase 3 ligand
    • SL cytokine
    see all
  • Function

    Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab237554.

References

ab237554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up