Recombinant human Flt3 ligand/Flt3L protein (Animal Free) (ab179623)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 98% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
Description
-
Product name
Recombinant human Flt3 ligand/Flt3L protein (Animal Free)
See all Flt3 ligand/Flt3L proteins and peptides -
Biological activity
OCI-AML5 cell proliferation: ED50 ≤10ng/ml; ≥ 1.0 x 105 units/mg.
-
Purity
>= 98 % SDS-PAGE.
Also determined by HPCL and spectroscopy at 280 nm. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWR LVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQT NISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLE ATAPT -
Predicted molecular weight
18 kDa -
Amino acids
27 to 180 -
Additional sequence information
Extracellular domain
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab179623 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
This product is produced with no animal-derived raw products, animal free equipment and animal free protocols.
Previously labelled as Flt3 ligand.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.
Constituents: 0.16% Sodium phosphate, 0.29% Sodium chloride
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.
General Info
-
Alternative names
- FL
- Flt 3 ligand
- Flt 3L
see all -
Function
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
-
Functional analysis of ab179623
-
SDS PAGE analysis of ab179623 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab179623 has not yet been referenced specifically in any publications.