Description

  • Product name

    Recombinant Human FN3K-RP protein (denatured)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMEELLRRELGCSSVRATGHSGGGCISQ GRSYDTDQGRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVL DAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGT VGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQM DMVEKESGDREALQLWSALQLKIPDLFRDLEIIPALLHGDLWGGNVAEDS SGPVIFDPASFYGHSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRL QLYQLFHYLNHWNHFGSGYRGSSLNIMRNLVK
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 309
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Ketosamine-3-kinase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • EC 2.7.1.-
    • FLJ12171
    • FN3K related protein
    • FN3K-related protein
    • FN3K-RP
    • FN3KL
    • Fn3krp
    • Fn3krp fructosamine-3-kinase-related protein
    • FN3X
    • Fructosamine-3-kinase-related protein
    • Ketosamine-3-kinase
    • KT3K_HUMAN
    • MGC40640
    • RGD1304570
    • RP23-293H17.3
    • Testis secretory sperm binding protein Li 211a
    see all
  • Function

    Phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.
  • Tissue specificity

    Expressed in erythrocytes.
  • Sequence similarities

    Belongs to the fructosamine kinase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139242.

References

ab139242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up