Description

  • Product name

    Recombinant Human FNDC3A protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DPVIYSLQVMLGKDSEFKQIYKGPDSSFRYSSLQLNCEYRFRVCAIRQCQ DSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCA
    • Amino acids

      1012 to 1110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Fibronectin type III domain containing protein 3a
    • FNDC3
    • HUGO
    • KIAA0970
  • Relevance

    FNDC3A is a member of a three-gene family in mice. It is expressed in several tissues including testis, and encodes a novel protein composed of a proline-rich amino-terminus, nine fibronectin type-III domains, and a hydrophobic carboxy-terminus. The proline-rich region of each family member contains conserved amino acids that include a PPGY consensus binding site for type I WW domain containing proteins. The hydrophobic carboxy-terminus is similar to that found in 'tail-anchored' proteins, integral membrane proteins that are localized to the cytosolic face of the endoplasmic reticulum. Immunohistochemical staining has shown that FNDC3A localizes to the acrosome of spermatids, as well as to Leydig cells in the mouse testis. FNDC3A may be involved in mediating spermatid-Sertoli adhesion during mouse spermatogenesis and mutation of FNDC3A is the cause of male sterility in sys mice. FNDC3A has also been found to be overexpressed in human odontoblasts.

Images

  • ab161448 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up