Description

  • Product name

    Recombinant Human FNDC4 protein
  • Purity

    > 90 % SDS-PAGE.
    ab134867 was expressed in E. coli as inclusion bodies, refolded using a temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFDRPPSPVNVTVTHLRANSATV SWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYT VQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNS
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      45 to 148
    • Tags

      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: Potassium chloride, 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, Glycerol, Sodium chloride, 3.4% DL-Arginine

General Info

  • Alternative names

    • Fibronectin type III domain containing 4
    • Fibronectin type III domain containing protein 4
    • Fibronectin type III domain-containing protein 4
    • Fibronectin type III repeat containing protein 1
    • Fibronectin type III repeat-containing protein 1
    • FLJ22362
    • FNDC 4
    • FNDC4
    • FNDC4_HUMAN
    • FRCP 1
    • FRCP1
    see all
  • Sequence similarities

    Contains 1 fibronectin type-III domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab134867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up