Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFI QEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEK MASKNKDEVTMKE
    • Molecular weight

      13 kDa
    • Amino acids

      15 to 127

Specifications

Our Abpromise guarantee covers the use of ab134851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134851 was constructed by fully synthetic gene synthesis with codon optimization. ab134851 was expressed as non-fusion protein in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains a proprietary formulation of NaCl, EDTA, KCl, arginine, DTT and glycerol.

General Info

  • Alternative names

    • Fibronectin type III domain containing 5
    • Fibronectin type III domain-containing protein 5
    • Fibronectin type III repeat containing protein 2
    • Fibronectin type III repeat-containing protein 2
    • FNDC 5
    • Fndc5
    • FNDC5_HUMAN
    • FRCP2
    • irisin
    see all
  • Sequence similarities

    Contains 1 fibronectin type-III domain.
  • Cellular localization

    Peroxisome membrane. Imported in peroxisomes through the PEX5 receptor pathway.
  • Information by UniProt

References

ab134851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up