Bioactive grade

Recombinant human Folate Binding Protein/FBP (Active) (Biotin) (ab246060)

Description

  • Product name

    Recombinant human Folate Binding Protein/FBP (Active) (Biotin)
    See all Folate Binding Protein/FBP proteins and peptides
  • Biological activity

    Immobilized Folic acid-BSA conjugate at 5 μg/mL (100 μL/well) can bind ab246060 with a linear range of 8-125 ng/mL (QC tested).

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEA HKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSW RKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAA CQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEE VARFYAAAM
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      25 to 233
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • adult
    • Adult folate binding protein
    • Adult folate-binding protein
    • FBP
    • Folate Binding Protein
    • Folate receptor
    • Folate receptor 1
    • Folate Receptor 1 Adult
    • Folate Receptor 1 Precursor
    • Folate receptor adult
    • Folate receptor alpha
    • FOLR
    • FOLR1
    • FOLR1_HUMAN
    • FR alpha
    • FR-alpha
    • FRalpha
    • KB cells FBP
    • MOV18
    • Ovarian cancer associated antigen
    • Ovarian tumor associated antigen
    • Ovarian tumor associated antigen MOv18
    • Ovarian tumor-associated antigen MOv18
    see all
  • Function

    Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells.
  • Tissue specificity

    Exclusively expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum.
  • Involvement in disease

    Defects in FOLR1 are the cause of neurodegeneration due to cerebral folate transport deficiency (NCFTD) [MIM:613068]. NCFTD is an autosomal recessive disorder resulting from brain-specific folate deficiency early in life. Onset is apparent in late infancy with severe developmental regression, movement disturbances, epilepsy, and leukodystrophy. Note=Recognition and diagnosis of this disorder is critical because folinic acid therapy can reverse the clinical symptoms and improve brain abnormalities and function.
  • Sequence similarities

    Belongs to the folate receptor family.
  • Post-translational
    modifications

    Eight disulfide bonds are present.
    The secreted form is derived from the membrane-bound form either by cleavage of the GPI anchor, or/and by proteolysis catalyzed by a metalloprotease.
  • Cellular localization

    Cell membrane. Secreted.
  • Information by UniProt

Images

  • SDS-PAGE - Human Folate Binding Protein/FBP (Active) (ab246060).

    The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%. The protein migrates as 38-42 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

  • Immobilized Folic acid-BSA conjugate at 5 μg/mL (100 μL/well) can bind ab246060 with a linear range of 8-125 ng/mL (QC tested).

References

ab246060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up