Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQ CSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCL YECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNW HRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGS GRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQ LWLLG
    • Molecular weight

      56 kDa including tags
    • Amino acids

      1 to 255

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • beta hFR
    • FBP
    • FBP/PL 1
    • FBP2
    • fetal/placental
    • Folate receptor
    • Folate receptor 2
    • folate receptor 2 (fetal)
    • Folate receptor beta
    • Folate receptor, fetal/placental
    • Folbp 2
    • Folbp2
    • Folr2
    • FOLR2_HUMAN
    • FR beta
    • FR P3
    • FR-beta
    • Placental folate binding protein
    • Placental folate-binding protein
    see all
  • Function

    Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells.
  • Tissue specificity

    Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.
  • Sequence similarities

    Belongs to the folate receptor family.
  • Post-translational
    modifications

    Eight disulfide bonds are present.
    N-glycosylated.
  • Cellular localization

    Cell membrane. Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132596 stained with Coomassie Blue.

References

ab132596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up