Recombinant Human FOLR3 protein (ab158463)

Description

  • Product name

    Recombinant Human FOLR3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPE DELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHF IQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSY TCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVS NYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
    • Amino acids

      1 to 245
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Folate receptor 3
    • Folate receptor 3 (gamma)
    • Folate receptor gamma
    • FOLR3
    • FOLR3_HUMAN
    • FR G
    • FR-gamma
    • Gamma hFR
    see all
  • Function

    Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate.
  • Tissue specificity

    Spleen, thymus, bone marrow, ovarian carcinoma, and uterine carcinoma.
  • Sequence similarities

    Belongs to the folate receptor family.
  • Post-translational
    modifications

    Eight disulfide bonds are present.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab158463 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up