Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDM PGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREET LTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELES EIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKE DGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPS YTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL
    • Molecular weight

      57 kDa including tags
    • Amino acids

      50 to 338

Specifications

Our Abpromise guarantee covers the use of ab152396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Activator protein 1
    • AP 1
    • DKFZp686C0818
    • FBJ murine osteosarcoma viral oncogene homolog B
    • fosB
    • FOSB_HUMAN
    • G0/G1 switch regulatory protein 3
    • G0S3
    • GOS 3
    • GOS B
    • GOS3
    • GOSB
    • MGC42291
    • Oncogene FOS B
    • Oncogene FOSB
    • Protein fos B
    • Protein fosB
    see all
  • Function

    FosB interacts with Jun proteins enhancing their DNA binding activity.
  • Sequence similarities

    Belongs to the bZIP family. Fos subfamily.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152396 stained with Coomassie Blue.

References

ab152396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

I can confirm that ab152396 is tagged with GST. The GST tag is at the N-terminal end and it can be cleaved from the fusion protein by PreScission Protease (Amersham Biosciences).

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up