Overview

  • Product name

    Recombinant Human FOXA3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      29 amino acid tag-GEFLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLN PLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGA PGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIY QWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALH PSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPA ATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKL DAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSR SLLNASLEESGGGGSPGRRRRRRRRRRR
    • Molecular weight

      37 kDa
    • Amino acids

      2 to 350

Specifications

Our Abpromise guarantee covers the use of ab134839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Cell differentiation

  • Purity

    > 90 % SDS-PAGE.
    ab134839 was expressed in E. coli as inclusion bodies, refolded using a temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains a proprietary formulation of NaCl, EDTA, KCl, arginine, DTT and glycerol.

General Info

  • Alternative names

    • FKHH3
    • Fork head-related protein FKH H3
    • forkhead box A3
    • Forkhead box protein A3
    • Foxa3
    • FOXA3_HUMAN
    • hepatic nuclear factor-3-beta
    • hepatocyte nuclear factor 3
    • hepatocyte nuclear factor 3 gamma
    • Hepatocyte nuclear factor 3-gamma
    • HNF-3-gamma
    • HNF-3G
    • HNF3B
    • HNF3G
    • TCF-3G
    • TCF3G
    • Transcription factor 3G
    see all
  • Function

    Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites (By similarity). Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis.
  • Tissue specificity

    Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined.
  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Developmental stage

    Detected in prenatal liver nuclear extracts (12.4-27 weeks estimated gestational age). Not detected in postnatal liver samples.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab134839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up