Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMP NTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS
    • Amino acids

      22 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FKHL16
    • Forkhead box M1
    • Forkhead box protein M1
    • forkhead like 16
    • Forkhead-related protein FKHL16
    • FOX M1
    • Foxm1
    • FOXM1_HUMAN
    • FOXM1B
    • Hepatocyte nuclear factor 3 forkhead homolog 11
    • HFH-11
    • HFH11
    • HNF-3/fork-head homolog 11
    • HNF3
    • INS1
    • M phase phosphoprotein 2
    • M-phase phosphoprotein 2
    • MPHOSPH2
    • MPM-2 reactive phosphoprotein 2
    • MPP2
    • PIG29
    • TGT3
    • Transcription factor Trident
    • Trident
    • WIN
    • Winged-helix factor from INS-1 cells
    • Winged-helix factor from INS1 cells
    see all
  • Function

    Transcriptional activatory factor. May play a role in the control of cell proliferation.
  • Tissue specificity

    Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis.
  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Developmental stage

    Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus.
  • Domain

    Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4.
  • Post-translational
    modifications

    Phosphorylated in M (mitotic) phase.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab158448 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up