Description

  • Product name

    Recombinant Human FOXP1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAAD LAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAET KMSGPVCQPNPSPF
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      1 to 114

Specifications

Our Abpromise guarantee covers the use of ab132166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 12CC4
    • FLJ23741
    • Fork head related protein like B
    • Forkhead box P1
    • Forkhead box protein P1
    • FOX P1
    • FOXP 1
    • foxp1
    • FOXP1_HUMAN
    • Glutamine rich factor 1
    • hFKH1B
    • HSPC215
    • MGC12942
    • MGC88572
    • MGC99551
    • QRF 1
    • QRF1
    see all
  • Function

    Transcriptional repressor. It plays an important role in the specification and differentiation of lung epithelium. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Essential transcriptional regulator of B cell development.
  • Involvement in disease

    Note=A chromosomal aberration involving FOXP1 is found in acute lymphoblastic leukemia. Translocation t(9;3)(p13;p14.1) with PAX5.
    Defects in FOXP1 are the cause of mental retardation with language impairment and autistic features (MRLIAF) [MIM:613670]. It is a developmental disorder characterized by mild to moderate mental retardation, language impairment, and autistic features. Patients show global delay, delayed walking, severely delayed speech development, and behavioral abnormalities, including irritability, hyperactivity, aggression, and stereotypical rigid behaviors.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
    Contains 1 fork-head DNA-binding domain.
  • Domain

    The leucine-zipper is required for dimerization and transcriptional repression.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132166 stained with Coomassie Blue.

References

ab132166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up