Description

  • Product name

    Recombinant Human FOXP3 protein (His tag)
    See all FOXP3 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDL RGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRP HFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLP PGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCK WPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEK EKLSAMQAHL
    • Predicted molecular weight

      32 kDa
    • Amino acids

      1 to 260
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • AIID
    • DIETER
    • Forkhead box P3
    • Forkhead box protein P3
    • FOXP3
    • FOXP3_HUMAN
    • FOXP3delta7
    • Immune dysregulation polyendocrinopathy enteropathy X linked
    • Immunodeficiency polyendocrinopathy enteropathy X linked
    • IPEX
    • JM2
    • MGC141961
    • MGC141963
    • OTTHUMP00000025832
    • OTTHUMP00000025833
    • OTTHUMP00000226737
    • PIDX
    • Scurfin
    • XPID
    see all
  • Function

    Probable transcription factor. Plays a critical role in the control of immune response.
  • Involvement in disease

    Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) [MIM:304790]; also known as X-linked autoimmunity-immunodeficiency syndrome. IPEX is characterized by neonatal onset insulin-dependent diabetes mellitus, infections, secretory diarrhea, trombocytopenia, anemia and eczema. It is usually lethal in infancy.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
    Contains 1 fork-head DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226445 with 5% enrichment gel and 15% separation gel.

References

ab226445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up