Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MMVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGA DSNGEMSPAELLHFQQQQALQVARQFLLQQASGLSSPGNNDSKQSASAVQ VPVSVAMMSPQMLTPQQMQQILSPPQLQALLQQQQALMLQQEYYKKQQEQ LHLQLLTQQQAGKPQPKEALGNKQLAFQQQLLQMQQLQQQHLLNLQRQGL VSLQPNQASGPLQTLPQAAVCPTDLPQLWKGEGAPGQPAEDSVKQEGLDL TGTAATATSFAAPPKVSPPLSHHTLPNGQPTVLTSRRDSSSHEETPGSHP LYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQL EIQLAKESERLQAMMAHLHMRPSEPKPFSQPLNPVPGSSSFSKVTVSAAD SFPDGLVHPPTSAAAPVTPLRPPGLGSASLHGGGPARRRSSDKFCSPISS ELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFA YFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRRPPKMT GSPTLVKNMISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLP LSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGP PLGAPNPSASGPPEDRDLEEELPGEELS
    • Molecular weight

      100 kDa including tags
    • Amino acids

      1 to 678

Specifications

Our Abpromise guarantee covers the use of ab132183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1200010K03Rik
    • 2310007G05Rik
    • FKHLA
    • FLJ40908
    • FLJ44184
    • Fork head related protein like A
    • Fork head-related protein-like A
    • Forkhead box P4
    • Forkhead box protein P4
    • FOX P4
    • FOXP 4
    • foxp4
    • FOXP4_HUMAN
    • hFKHLA
    • mFKHLA
    • OTTHUMP00000016374
    • OTTHUMP00000039784
    • OTTHUMP00000043412
    • OTTHUMP00000043536
    • Winged helix repressor FOX P4
    • Winged helix repressor FOXP 4
    • Winged helix repressor FOXP4
    see all
  • Function

    Transcriptional repressor that represses lung-specific expression.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
    Contains 1 fork-head DNA-binding domain.
  • Domain

    The leucine-zipper is required for dimerization and transcriptional repression.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132183 stained with Coomassie Blue.

References

ab132183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up