Description

  • Product name

    Recombinant Human FOXQ1 protein
    See all FOXQ1 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGS YTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVF RRRRKRLSHR
    • Amino acids

      110 to 219
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Forkhead box protein Q1
    • Forkhead box Q1
    • FOX Q1
    • FOXQ 1
    • FOXQ1
    • FOXQ1_HUMAN
    • Hepatocyte nuclear factor 3 forkhead
    • Hepatocyte nuclear factor 3 forkhead homolog 1
    • HFH 1
    • HFH-1
    • HFH1
    • HNF 3/forkhead like protein 1
    • HNF-3/forkhead-like protein 1
    • HNF3/forkhead like protein 1
    • MGC77469
    • Q1
    • Winged helix / forkhead transcription factor
    • Winged helix/forkhead transcription factor
    • zgc:77469
    see all
  • Tissue specificity

    Expressed predominantly in the stomach, trachea, bladder and salivary gland.
  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153576 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up