Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMG RFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHD MFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGR QCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKP ACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQC RLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWV AGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
    • Amino acids
      1 to 330
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FKHL18
    • forkhead (Drosophila)-like 18
    • Forkhead box protein S1
    • Forkhead box S1
    • forkhead-like 18 (Drosophila)
    • Forkhead-like 18 protein
    • Forkhead-related activator 10
    • Forkhead-related transcription factor 10
    • Forkhead-related transcription factor FREAC-10
    • Foxs1
    • FOXS1_HUMAN
    • FREAC 10
    • FREAC-10
    • FREAC10
    • MGC4544
    see all
  • Function
    Transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters. May have a role in the organization of the testicular vasculature.
  • Sequence similarities
    Contains 1 fork-head DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158449 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up