Overview

  • Product name
    Recombinant Human FPGS protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLM AFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLL
    • Amino acids
      135 to 232
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Folylpolyglutamate synthase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 6.3.2.17
    • FOLC
    • FOLC_HUMAN
    • Folylpoly gamma glutamate synthetase
    • Folylpoly-gamma-glutamate synthetase
    • Folylpolyglutamate synthase
    • Folylpolyglutamate synthase mitochondrial
    • FPGS
    • mitochondrial
    • OTTHUMP00000022201
    • OTTHUMP00000022202
    • Tetrahydrofolate synthase
    • Tetrahydrofolylpolyglutamate synthase
    see all
  • Function
    Conversion of folates to polyglutamate derivatives. This allows tissues to concentrate folate at higher levels than in plasma.
  • Pathway
    Cofactor biosynthesis; tetrahydrofolylpolyglutamate biosynthesis.
  • Sequence similarities
    Belongs to the folylpolyglutamate synthase family.
  • Cellular localization
    Mitochondrion. Cytoplasm.
  • Information by UniProt

Images

  • ab158464 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up